PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G25330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 170aa    MW: 19887.1 Da    PI: 7.2144
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G25330.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.27.3e-1380134458
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                       +r rr+++NRe+ArrsR RK++++ eL   v  L + N++L ++l++    +++
  LPERR02G25330.1  80 ERRRRRMISNRESARRSRMRKQKQLSELWAQVVHLRSTNRQLLDQLNHVIRDCDR 134
                      6899***************************************999998877776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.6E-1377141IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-1077134No hitNo description
PROSITE profilePS5021710.55379142IPR004827Basic-leucine zipper domain
PfamPF001703.9E-1079128IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.44E-1281131No hitNo description
PROSITE patternPS0003608499IPR004827Basic-leucine zipper domain
CDDcd147021.00E-1486133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MYPAEIASFP YLSPATAVSF KTHYHVDTND FLLQYNSLLV SQATSYQQHV AHLPDETSLP  60
AGNKSNSDES DDYQRSLAEE RRRRRMISNR ESARRSRMRK QKQLSELWAQ VVHLRSTNRQ  120
LLDQLNHVIR DCDRIAHENC QLRDEQAKLQ KQLEKIPLEN TESTFMDPDT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
180101RRRRRMISNRESARRSRMRKQK
293100RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00647PBMTransfer from LOC_Os02g49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0052840.0AP005284.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:B1121A12.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624540.11e-110PREDICTED: basic leucine zipper 43-like
TrEMBLA0A0D9VKI61e-124A0A0D9VKI6_9ORYZ; Uncharacterized protein
STRINGOB02G38090.11e-110(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G38800.12e-15basic leucine-zipper 43